It’s only fair to share… Gedatolisib Approvals 3026, FDA 2026, 7/14/2026, Revtorpyk PF-05212384; PF-5212384; PKI-587CAS 1197160-78-3Chemical Formula: C32H41N9O4Molecular Weight: 615.721-(4-{[4-(Dimethylamino)-1-piperidinyl]carbonyl}phenyl)-3-{4-[4,6-di(4-morpholinyl)-1,3,5-triazin-2-yl]phenyl}urea3-{4-[bis(morpholin-4-yl)-1,3,5-triazin-2-yl]phenyl}-1-{4-[4-(dimethylamino)piperidine-1-carbonyl]phenyl}ureaN-[4-[[4-(Dimethylamino)-1-piperidinyl]carbonyl]phenyl]-N’-[4-[4,6-di(4-morpholinyl)-1,3,5-triazin-2-yl]phenyl]ureaгедатолисиб [Russian] [INN]غيداتوليسيب [Arabic] [INN]吉达利塞 [Chinese] [INN] 1-(4-(4-(Dimethylamino)piperidine-1-carbonyl)phenyl)-3-(4-(4,6-dimorpholino-1,3,5-triazin-2-yl)phenyl)urea Urea, N-[4-[[4-(dimethylamino)-1-piperidinyl]carbonyl]phenyl]-N’-[4-(4,6-di-4-morpholinyl-1,3,5-triazin-2-yl)phenyl]- 96265TNH2R In combination with fulvestran, to treat hormone receptor-positive, human epidermal growth factor receptor 2-negative, locally advanced or metastatic breast cancer without a PIK3CA mutation detected following progression on or after treatment …
Tag «PFIZER»
NERIGLIATIN
It’s only fair to share… PF 04937319, NERIGLIATIN N,N-dimethyl-5-(2-methyl-6-((5-methylpyrazin-2-yl)-carbamoyl)benzofuran-4-yloxy)pyrimidine-2-carboxamide MW 432.43, MF C22 H20 N6 O4 CAS 1245603-92-2 2-Pyrimidinecarboxamide, N,N-dimethyl-5-[[2-methyl-6-[[(5-methyl-2-pyrazinyl)amino]carbonyl]-4-benzofuranyl]oxy]- N,N-Dimethyl-5-(2-methyl-6-((5-methylpyrazin-2-yl)carbamoyl)-benzofuran-4- yloxy)pyrimidine-2-carboxamide Pfizer Inc. clinical candidate currently in Phase 2 development. SCHEME REF MedChemComm (2011), 2(9), 828-839 81% WO2010103437 CLINICAL TRIALS A trial to assess the safety, tolerability, pharmacokinetics, and pharmacodynamics of single doses of PF-04937319 …
Ervogastat
It’s only fair to share… Ervogastat CAS 2186700-33-2 Non-alcoholic Steatohepatitis (NASH) with Liver Fibrosis (FAST TRACK – U.S.) 2-[5-(3-ethoxypyridin-2-yl)oxypyridin-3-yl]-N-[(3S)-oxolan-3-yl]pyrimidine-5-carboxamide Phase IINon-alcoholic fatty liver disease; Non-alcoholic steatohepatitis Ervogastat is an experimental small-molecule drug and selective diacylglycerol O-acyltransferase 2 inhibitor developed by Pfizer for non-alcoholic steatohepatitis.[1] Its development was previously halted by the company but resumed in 2022.[2] Scheme SIDE CHAIN MAIN https://doi.org/10.1021/acs.jmedchem.2c01200 SYN …
SC-52458, FORASARTAN
It’s only fair to share… SC-52458, FORASARTAN Molecular FormulaC23H28N8 Average mass416.522 Da PHASE 2, PFIZER, HYPERTENSION 145216-43-9 [RN] 5-[(3,5-Dibutyl-1H-1,2,4-triazol-1-yl)methyl]-2-[2-(1H-tetrazol-5-yl)phenyl]pyridine 5-[(3,5-dibutyl-1H-1,2,4-triazol-1-yl)methyl]-2-[2-(2H-1,2,3,4-tetrazol-5-yl)phenyl]pyridine форасартан [Russian] [INN], فوراسارتان[Arabic][INN], 福拉沙坦[Chinese][INN] 065F7WPT0B [DBID] 7415 [DBID] UNII-065F7WPT0B [DBID] SC 52458 [DBID] Type-1 angiotensin II receptor Forasartan, otherwise known as the compound SC-52458, is a nonpeptide angiotensin II receptor antagonist (ARB, AT1 receptor blocker).[2][3][4][5] Forasartan, a specific angiotensin II antagonist, is used alone or with …
Somatrogon
It’s only fair to share… >Somatrogon amino acid sequence SSSSKAPPPSLPSPSRLPGPSDTPILPQFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFE EAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQF LRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHN DDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFSSSSKAPPPSLPSPSRLPGPS DTPILPQSSSSKAPPPSLPSPSRLPGPSDTPILPQ Somatrogon CAS: 1663481-09-1 Protein Chemical FormulaC1359H2125N361O420S7 Protein Average Weight30465.1 Da (Aglycosylated) NGENLA, JAPAN PMDA APPROVED 2022/1/20 ソマトロゴン; MOD-4023 Replenisher (somatotoropin) OriginatorModigene DeveloperOPKO Health; Pfizer ClassBiological proteins; Growth hormones; Hormonal replacements; Recombinant proteins Mechanism of ActionHuman growth hormone replacements Orphan Drug StatusYes – …
PF 04965842, Abrocitinib
It’s only fair to share… PF-04965842 PF 04965842, Abrocitinib UNII: 73SM5SF3OR CAS Number 1622902-68-4, Empirical Formula C14H21N5O2S, Molecular Weight 323.41 N-[cis-3-(Methyl-7H-pyrrolo[2,3-d]pyrimidin-4-ylamino)cyclobutyl]-1-propanesulfonamide, N-((1s,3s)-3-(methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)cyclobutyl)propane-1-sulfonamide 1-Propanesulfonamide, N-(cis-3-(methyl-7H-pyrrolo(2,3-d)pyrimidin-4-ylamino)cyclobutyl)- N-{cis-3-[Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino]cyclobutyl}-propane-1-sulfonamide PHASE 3, for the potential oral treatment of moderate-to-severe atopic dermatitis (AD) Jak1 tyrosine kinase inhibitor THE US In February 2018, the FDA granted Breakthrough Therapy designation for the treatment of patients with moderate-to-severe …
PF 06650808
It’s only fair to share… . Picture credit….Bethany Halford PF 06650808 CAS 1822383-80-1 A biologic for cancer treatment (Pfizer Inc.) Originator Pfizer Class Antineoplastics Mechanism of Action Notch-3 receptor antagonists No development reported Solid tumours 24 Jun 2018 Biomarkers information updated 28 Apr 2018 No recent reports of development identified for phase-I development in Solid-tumours(Late-stage disease) in USA (IV) 01 Jul 2017 Pfizer …
Gedatolisib, гедатолисиб , غيداتوليسيب , 吉达利塞 ,
It’s only fair to share… Gedatolisib Pfizer PF-05212384; PF-5212384; PKI-587 CAS 1197160-78-3 Chemical Formula: C32H41N9O4 Molecular Weight: 615.72 1-(4-{[4-(Dimethylamino)-1-piperidinyl]carbonyl}phenyl)-3-{4-[4,6-di(4-morpholinyl)-1,3,5-triazin-2-yl]phenyl}urea 3-{4-[bis(morpholin-4-yl)-1,3,5-triazin-2-yl]phenyl}-1-{4-[4-(dimethylamino)piperidine-1-carbonyl]phenyl}urea N-[4-[[4-(Dimethylamino)-1-piperidinyl]carbonyl]phenyl]-N‘-[4-[4,6-di(4-morpholinyl)-1,3,5-triazin-2-yl]phenyl]urea гедатолисиб [Russian] [INN] غيداتوليسيب [Arabic] [INN] 吉达利塞 [Chinese] [INN] Phase III Acute myeloid leukaemia Phase II Colorectal cancer; Non-small cell lung cancer Phase I Breast cancer; Solid tumours Discontinued Endometrial cancer Most Recent Events 22 Nov 2017Pfizer suspends patient enrolment in a phase I/II …
TAFAMIDIS
It’s only fair to share… Tafamidis Molecular Formula C14H7Cl2NO3 Average mass 308.116 Da TAFAMIDIS, Fx-1006A PF-06291826 2-(3,5-Dichlorophenyl)-1,3-benzoxazole-6-carboxylic acid 594839-88-0 [RN] 6-Benzoxazolecarboxylic acid, 2-(3,5-dichlorophenyl)- Vyndaqel Tafamidis meglumine Familial amyloid polyneuropathy LAUNCHED PFIZER 2011 EU ApprovedJapanese Pharmaceuticals and Medical Devices Agency in September 2013 PHASE 3, at FDA, Amyloidosis, PFIZER Molecular Formula: C21H24Cl2N2O8 Molecular Weight: 503.329 g/mol CAS 951395-08-7 http://www.ema.europa.eu/docs/en_GB/document_library/EPAR_-_Public_assessment_report/human/002294/WC500117838.pdf D-Glucitol, 1-deoxy-1-(methylamino)-, 2-(3,5-dichlorophenyl)-6-benzoxazolecarboxylate Tafamidis (INN, or Fx-1006A,[1] trade …
FDA approves Mylotarg (gemtuzumab ozogamicin) for treatment of acute myeloid leukemia
It’s only fair to share… FDA approves Mylotarg for treatment of acute myeloid leukemia 09/01/2017 The U.S. Food and Drug Administration today approved Mylotarg (gemtuzumab ozogamicin) for the treatment of adults with newly diagnosed acute myeloid leukemia whose tumors express the CD33 antigen (CD33-positive AML). The FDA also approved Mylotarg for the treatment of patients …