
It’s only fair to share…   >Somatrogon amino acid sequence SSSSKAPPPSLPSPSRLPGPSDTPILPQFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFE EAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQF LRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHN DDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFSSSSKAPPPSLPSPSRLPGPS DTPILPQSSSSKAPPPSLPSPSRLPGPSDTPILPQ Somatrogon CAS: 1663481-09-1 Protein Chemical FormulaC1359H2125N361O420S7 Protein Average Weight30465.1 Da (Aglycosylated) NGENLA, JAPAN PMDA APPROVED 2022/1/20 ソマトロゴン; MOD-4023 Replenisher (somatotoropin) OriginatorModigene DeveloperOPKO Health; Pfizer ClassBiological proteins; Growth hormones; Hormonal replacements; Recombinant proteins Mechanism of ActionHuman growth hormone replacements Orphan Drug StatusYes – …

PF 04965842, Abrocitinib

It’s only fair to share…   PF-04965842 PF 04965842, Abrocitinib UNII: 73SM5SF3OR CAS Number 1622902-68-4, Empirical Formula  C14H21N5O2S, Molecular Weight 323.41 N-[cis-3-(Methyl-7H-pyrrolo[2,3-d]pyrimidin-4-ylamino)cyclobutyl]-1-propanesulfonamide, N-((1s,3s)-3-(methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)cyclobutyl)propane-1-sulfonamide 1-Propanesulfonamide, N-(cis-3-(methyl-7H-pyrrolo(2,3-d)pyrimidin-4-ylamino)cyclobutyl)- N-{cis-3-[Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino]cyclobutyl}-propane-1-sulfonamide PHASE 3, for the potential oral treatment of moderate-to-severe atopic dermatitis (AD) Jak1 tyrosine kinase inhibitor THE US In February 2018, the FDA granted Breakthrough Therapy designation for the treatment of patients with moderate-to-severe …

PF 06650808

It’s only fair to share… . Picture credit….Bethany Halford PF 06650808 CAS 1822383-80-1 A biologic for cancer treatment (Pfizer Inc.) Originator Pfizer Class Antineoplastics Mechanism of Action Notch-3 receptor antagonists No development reported Solid tumours 24 Jun 2018 Biomarkers information updated 28 Apr 2018 No recent reports of development identified for phase-I development in Solid-tumours(Late-stage disease) in USA (IV) 01 Jul 2017 Pfizer …

Gedatolisib, гедатолисиб , غيداتوليسيب , 吉达利塞 ,

It’s only fair to share… Gedatolisib Pfizer PF-05212384; PF-5212384; PKI-587 CAS 1197160-78-3 Chemical Formula: C32H41N9O4 Molecular Weight: 615.72 1-(4-{[4-(Dimethylamino)-1-piperidinyl]carbonyl}phenyl)-3-{4-[4,6-di(4-morpholinyl)-1,3,5-triazin-2-yl]phenyl}urea 3-{4-[bis(morpholin-4-yl)-1,3,5-triazin-2-yl]phenyl}-1-{4-[4-(dimethylamino)piperidine-1-carbonyl]phenyl}urea N-[4-[[4-(Dimethylamino)-1-piperidinyl]carbonyl]phenyl]-N‘-[4-[4,6-di(4-morpholinyl)-1,3,5-triazin-2-yl]phenyl]urea гедатолисиб [Russian] [INN] غيداتوليسيب [Arabic] [INN] 吉达利塞 [Chinese] [INN] Phase III Acute myeloid leukaemia Phase II Colorectal cancer; Non-small cell lung cancer Phase I Breast cancer; Solid tumours Discontinued Endometrial cancer Most Recent Events 22 Nov 2017Pfizer suspends patient enrolment in a phase I/II …


It’s only fair to share… Tafamidis Molecular Formula C14H7Cl2NO3 Average mass 308.116 Da TAFAMIDIS, Fx-1006A PF-06291826 2-(3,5-Dichlorophenyl)-1,3-benzoxazole-6-carboxylic acid 594839-88-0 [RN] 6-Benzoxazolecarboxylic acid, 2-(3,5-dichlorophenyl)- Vyndaqel Tafamidis meglumine Familial amyloid polyneuropathy LAUNCHED PFIZER 2011 EU ApprovedJapanese Pharmaceuticals and Medical Devices Agency in September 2013 PHASE 3, at  FDA, Amyloidosis, PFIZER Molecular Formula: C21H24Cl2N2O8 Molecular Weight: 503.329 g/mol CAS 951395-08-7 http://www.ema.europa.eu/docs/en_GB/document_library/EPAR_-_Public_assessment_report/human/002294/WC500117838.pdf D-Glucitol, 1-deoxy-1-(methylamino)-, 2-(3,5-dichlorophenyl)-6-benzoxazolecarboxylate Tafamidis (INN, or Fx-1006A,[1] trade …

FDA approves Mylotarg (gemtuzumab ozogamicin) for treatment of acute myeloid leukemia

It’s only fair to share… FDA approves Mylotarg for treatment of acute myeloid leukemia 09/01/2017 The U.S. Food and Drug Administration today approved Mylotarg (gemtuzumab ozogamicin) for the treatment of adults with newly diagnosed acute myeloid leukemia whose tumors express the CD33 antigen (CD33-positive AML). The FDA also approved Mylotarg for the treatment of patients …

PF 2562

It’s only fair to share… PF 2562 CAS 1609258-91-4 MF C19 H17 N5 O MW 331.37 1H-Pyrazolo[4,3-c]pyridine, 4-[4-(4,6-dimethyl-5-pyrimidinyl)-3-methylphenoxy]- Inventors Jennifer Elizabeth Davoren, Amy Beth Dounay, Ivan Viktorovich Efremov, David Lawrence Firman Gray, Scot Richard Mente, Steven Victor O’Neil, Bruce Nelsen Rogers, Chakrapani Subramanyam, Lei Zhang Original Assignee Pfizer Inc Jennifer Elizabeth Davoren Principal Scientist at Pfizer   …

PF 06821497

It’s only fair to share…   PF 06821497 Cas 1844849-11-1 Designed to treat lymphoma 1(2H)-Isoquinolinone, 5,8-dichloro-2-[(1,2-dihydro-4-methoxy-6-methyl-2-oxo-3-pyridinyl)methyl]-3,4-dihydro-7-[(S)-methoxy-3-oxetanylmethyl]- MF C22 H24 Cl2 N2 O5,  MW 467.34 PF 06821497 5,8-Dichloro-2-[(4-methoxy-6-methyl-2-oxo-1,2-dihydro-3-pyridinyl)methyl]-7-[methoxy(3-oxetanyl)methyl]-3,4-dihydro-1(2H)-isoquinolinone 1(2H)-Isoquinolinone, 5,8-dichloro-2-[(1,2-dihydro-4-methoxy-6-methyl-2-oxo-3-pyridinyl)methyl]-3,4-dihydro-7-(methoxy-3-oxetanylmethyl)- Molecular Formula C22H24Cl2N2O5 Average mass 467.342 Da PF 06821497 5,8-dichloro-2-[(4-methoxy-6-methyl-2-oxo-1H-pyridin-3-yl)methyl]-7-[(S)-methoxy(oxetan-3-yl)methyl]-3,4-dihydroisoquinolin-1-one US2015361067 Inventors Michael Raymond Collins, Robert Steven Kania, Robert Arnold Kumpf, Pei-Pei Kung, Daniel Tyler Richter, Scott Channing Sutton, …

Lorlatinib, лорлатиниб , لورلاتينيب , 洛拉替尼 , PF-6463922

It’s only fair to share… Lorlatinib, PF-6463922 For Cancer; Non-small-cell lung cancer Molecular Formula C21H19FN6O2 Average mass 406.413 Da Phase 2 WO 2013132376 Andrew James Jensen, Suman Luthra, Paul Francis RICHARDSON Applicant Pfizer Inc. (10R)-7-amino-12-fluoro-2,10,16-trimethyl-15-oxo-10,15,16,17-tetrahydro-2H-4,8- methenopyrazolo[4,3-h][2,5,11]benzoxadiazacyclotetradecine-3-carbonitrile (16R)-19-Amino-13-fluoro-4,8,16-trimethyl-9-oxo-17-oxa-4,5,8,20-tetraazatetracyclo[,6.010,15]docosa-1(22),2,5,10,12,14,18,20-octaene-3-carbonitrile (10R)-7-Amino-12-fluoro-2,10,16-trimethyl-15-oxo-10,15,16,17-tetrahydro-2H-8,4-(metheno)pyrazolo[4,3-h][2,5,11]benzoxadiazacyclotetradecine-3-carbonitrile CAS 1454846-35-5 [RN] UNII:OSP71S83EU лорлатиниб [Russian] لورلاتينيب [Arabic] 洛拉替尼 [Chinese] Ros1 tyrosine kinase receptor inhibitor; Anaplastic lymphoma kinase receptor inhibitor useful …


It’s only fair to share…   PF-04745637 cas 1917294-46-2 MW 509.00, MF C27 H32 Cl F3 N2 O2 Cyclopentanecarboxamide, 1-(4-chlorophenyl)-N-[2-[4-hydroxy-4-(trifluoromethyl)-1-piperidinyl]-3-phenylpropyl]- rac-1-(4-Chlorophenyl)-N-f2-r4-hvdroxy-4-(trifluoromethyl)piperidin-1-vn-3-phenylpropyDcyclopentanecarboxamide PRODUCT PATENT WO-2016067143-A1 Applicants: PFIZER INC. [US/US]; 235 East 42nd Street New York, New York 10017 (US) Inventors: SWAIN, Nigel Alan; (GB). PRYDE, David Cameron; (GB). RAWSON, David James; (GB). RYCKMANS, Thomas; (GB). SKERRATT, Sarah Elizabeth; (GB). …