OTESECONAZOLE

It’s only fair to share… OTESECONAZOLE VT 1161 (2R)-2-(2,4-difluorophenyl)-1,1-difluoro-3-(tetrazol-1-yl)-1-[5-[4-(2,2,2-trifluoroethoxy)phenyl]pyridin-2-yl]propan-2-ol C23H16F7N5O2   527.4 Synonyms VT 1161 Oteseconazole 1340593-59-0 Other Names (αR)-α-(2,4-Difluorophenyl)-β,β-difluoro-α-(1H-tetrazol-1-ylmethyl)-5-[4-(2,2,2-trifluoroethoxy)phenyl]-2-pyridineethanol (2R)-2-(2,4-difluorophenyl)-1,1-difluoro-3-(1H-1,2,3,4-tetrazol-1-yl)- 1-{5-[4-(2,2,2-trifluoroethoxy)phenyl]pyridin-2-yl}propan-2-ol  Oteseconazole, also known as VT-1161, is a tetrazole antifungal agent potentially for the treatment of candidal vaginal infection. VT-1161 Protects Immunosuppressed Mice from Rhizopus arrhizus var. arrhizus Infection. VT-1161 dosed once daily or …

Nangibotide

It’s only fair to share… Nangibotide LQEEDAGEYGCM-amide CAS 2014384-91-7 Molecular FormulaC54H82N14O22S2 Average mass1343.439 Da 2014384‐91‐7 L-Leucyl-L-glutaminyl-L-α-glutamyl-L-α-glutamyl-L-α-aspartyl-L-alanylglycyl-L-α-glutamyl-L-tyrosylglycyl-L-cysteinyl-L-methioninamide LR 12 peptide LQEEDAGEYG CM L-Leucyl-L-glutaminyl-L-glutaminyl-L-α-glutamyl-L-α-aspartyl-L-alanylglycyl-L-α-glutamyl-L-tyrosylglycyl-L-cysteinyl-L-methionine L-Methionine, L-leucyl-L-glutaminyl-L-glutaminyl-L-α-glutamyl-L-α-aspartyl-L-alanylglycyl-L-α-glutamyl-L-tyrosylglycyl-L-cysteinyl- нангиботид مانغيبوتيد 南吉博肽 Sequence (one letter code) LQEEDAGEYGCM-amide Sequence (three letter code) H-Leu-Gln-Glu-Glu-Asp-Ala-Gly-Glu-Tyr-Gly-Cys-Met-NH2 OriginatorInotrem ClassAnti-infectives; Anti-inflammatories; Anti-ischaemics; Antivirals; Peptides Mechanism of ActionTREML1 protein inhibitors Phase II/IIICOVID 2019 infections Phase IISeptic shock Phase …

Melarsoprol

It’s only fair to share… Melarsoprol Melarsoprol CAS Registry Number: 494-79-1 CAS Name: 2-[4-[(4,6-Diamino-1,3,5-triazin-2-yl)amino]phenyl]-1,3,2-dithiarsolane-4-methanol Additional Names: p-[(4,6-diamino-s-triazin-2-yl)amino]dithiobenzenearsonous acid 3-hydroxypropylene ester; 2-p-(4,6-diamino-s-triazin-2-ylamino)phenyl-4-hydroxymethyl-1,3,2-dithiarsoline; 2-(4-melamin-2-ylphenyl)-4-hydroxymethyl-1,3-dithia-2-arsolane Trademarks: Mel B; Arsobal (Specia) Molecular Formula: C12H15AsN6OS2 Molecular Weight: 398.34 Percent Composition: C 36.18%, H 3.80%, As 18.81%, N 21.10%, O 4.02%, S 16.10% Literature References: Prepn: Friedheim, US 2659723 (1953); US 2772303 (1956). Properties: Practically insol in water, cold ethanol, methanol. Sol in propylene glycol. Therap-Cat: Antiprotozoal …

Rilzabrutinib

It’s only fair to share… PRN 1008, Rilzabrutinib CAS 1575591-66-0 リルザブルチニブ; C36H40FN9O3, MW 665.7597 2-[(3R)-3-[4-amino-3-(2-fluoro-4-phenoxyphenyl)pyrazolo[3,4-d]pyrimidin-1-yl]piperidine-1-carbonyl]-4-methyl-4-[4-(oxetan-3-yl)piperazin-1-yl]pent-2-enenitrile Anti-inflammatory disease, Autoimmune disease treatment OriginatorPrincipia Biopharma Class2 ring heterocyclic compounds; Amines; Anti-inflammatories; Fluorobenzenes; Nitriles; Phenyl ethers; Piperazines; Piperidines; Pyrazoles; Pyrimidines; Skin disorder therapies; Small molecules Mechanism of ActionAgammaglobulinaemia tyrosine kinase inhibitors Orphan Drug StatusYes – Idiopathic thrombocytopenic purpura; Pemphigus vulgaris Phase …

PRN-473

It’s only fair to share…   PRN-473 SAR-444727 1414354-91-8 C30 H30 F N7 O2 Molecular Weight539.60 1-Piperidinepropanenitrile, 3-[4-amino-3-(2-fluoro-4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]-α-(2,2-dimethylpropylidene)-β-oxo-, (3R)- (3R)-3-[4-Amino-3-(2-fluoro-4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]-α-(2,2-dimethylpropylidene)-β-oxo-1-piperidinepropanenitrile 2-(3-(4-amino~3-(2-fiuoro~4-phenoxyphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carbonyl)-4,4-dimethylpent-2-enenitrile 2-[(3R)-3-[4-amino-3-(2-fluoro-4-phenoxyphenyl)pyrazolo[3,4-d]pyrimidin-1-yl]piperidine-1-carbonyl]-4,4-dimethylpent-2-enenitrile OriginatorPrincipia Biopharma ClassSmall molecules Mechanism of ActionAgammaglobulinaemia tyrosine kinase inhibitors Phase IAutoimmune disorders DiscontinuedArthritis 28 Sep 2020Principia Biopharma has been acquired by Sanofi 22 Jun 2020Principia Biopharma plans a pharmacokinetic phase I trial (In volunteers) for Hypersensitivity …

DEUCRAVACITINIB

It’s only fair to share… DEUCRAVACITINIB BMS-986165 CAS 1609392-27-9, C20H22N8O3, 425.46 6-(cyclopropanecarbonylamino)-4-[2-methoxy-3-(1-methyl-1,2,4-triazol-3-yl)anilino]-N-(trideuteriomethyl)pyridazine-3-carboxamide 6-(cyclopropanecarboxamido)-4-((2-methoxy-3-(1-methyl-1H-1,2,4-triazol-3-yl)phenyl)amino)-N-(methyl-d3)pyridazine-3-carboxamide Tyk2-IN-4 UNII-N0A21N6RAU N0A21N6RAU GTPL10432 EX-A3154 BDBM50507816 NSC825520 s8879 OriginatorBristol-Myers Squibb ClassAmides; Aniline compounds; Anti-inflammatories; Antipsoriatics; Antirheumatics; Cyclopropanes; Ethers; Hepatoprotectants; Organic deuterium compounds; Pyridazines; Skin disorder therapies; Small molecules; Triazoles Mechanism of ActionTYK2 kinase inhibitors Phase IIIPlaque psoriasis Phase IICrohn’s disease; Lupus nephritis; Psoriatic arthritis; Systemic …

BELUMOSUDIL

It’s only fair to share… BELUMOSUDIL C26H24N6O2 MW 452.5 911417-87-3, SLx-2119, KD-025, KD 025, WHO 11343 2-[3-[4-(1H-indazol-5-ylamino)quinazolin-2-yl]phenoxy]-N-propan-2-ylacetamide 2-(3-(4-(lH-indazol-5-ylamino)quinazolin-2-yl)phenoxy)-N-isopropylacetamide Belumosudil mesylate KD025 mesylate 2109704-99-4 Belumosudil mesylate is an orally available rho kinase 2 (ROCK 2) inhibitor being developed at Kadmon. In 2020, the drug candidate was submitted for a new drug application (NDA) in the U.S., under a …

Asparaginase erwinia chrysanthemi (recombinant)-rywn

It’s only fair to share… Sequence: 1ADKLPNIVIL ATGGTIAGSA ATGTQTTGYK AGALGVDTLI NAVPEVKKLA 51NVKGEQFSNM ASENMTGDVV LKLSQRVNEL LARDDVDGVV ITHGTDTVEE 101SAYFLHLTVK SDKPVVFVAA MRPATAISAD GPMNLLEAVR VAGDKQSRGR 151GVMVVLNDRI GSARYITKTN ASTLDTFKAN EEGYLGVIIG NRIYYQNRID 201KLHTTRSVFD VRGLTSLPKV DILYGYQDDP EYLYDAAIQH GVKGIVYAGM 251GAGSVSVRGI AGMRKAMEKG VVVIRSTRTG NGIVPPDEEL PGLVSDSLNP 301AHARILLMLA LTRTSDPKVI QEYFHTY >Protein sequence for asparaginase (Erwinia chrysanthemi) monomer ADKLPNIVILATGGTIAGSAATGTQTTGYKAGALGVDTLINAVPEVKKLANVKGEQFSNM ASENMTGDVVLKLSQRVNELLARDDVDGVVITHGTDTVEESAYFLHLTVKSDKPVVFVAA MRPATAISADGPMNLLEAVRVAGDKQSRGRGVMVVLNDRIGSARYITKTNASTLDTFKAN EEGYLGVIIGNRIYYQNRIDKLHTTRSVFDVRGLTSLPKVDILYGYQDDPEYLYDAAIQH GVKGIVYAGMGAGSVSVRGIAGMRKAMEKGVVVIRSTRTGNGIVPPDEELPGLVSDSLNP AHARILLMLALTRTSDPKVIQEYFHTY References: Therapeutic Targets …

Soberana 02, FINLAY-FR-2

It’s only fair to share… Soberana 02 FINLAY-FR-2 cas 2543416-58-4 A SARS-CoV-2 vaccine comprising a conjugate of the spike protein RBD domain with tetanus toxoid (Finlay Vaccine Institute of Cuba) Soberana 02, is a conjugate vaccine developed by Instituto Finlay de Vacunas.[517] Cuba[518] Iran[517] 517 Zimmer, Carl; Corum, Jonathan; Wee, Sui-Lee. “Coronavirus Vaccine Tracker”. The New York Times. Retrieved 30 …

BPI-7711, Rezivertinib

It’s only fair to share… BPI-7711, Rezivertinib 1835667-12-3 C27H30N6O3, 486.576 N-[2-[2-(dimethylamino)ethoxy]-4-methoxy-5-[[4-(1-methylindol-3-yl)pyrimidin-2-yl]amino]phenyl]prop-2-enamide Beta Pharma in collaboration Chinese licensee CSPC Pharmaceuticals Group , is developing BPI-7711 In June 2021, this drug was reported to be in phase 3 clinical development. OriginatorBeta Pharma ClassAmides; Amines; Antineoplastics; Indoles; Phenyl ethers; Pyrimidines; Small molecules Mechanism of ActionEpidermal growth factor receptor antagonists …