It’s only fair to share… PF 04937319, NERIGLIATIN N,N-dimethyl-5-(2-methyl-6-((5-methylpyrazin-2-yl)-carbamoyl)benzofuran-4-yloxy)pyrimidine-2-carboxamide MW 432.43, MF C22 H20 N6 O4 CAS 1245603-92-2 2-Pyrimidinecarboxamide, N,N-dimethyl-5-[[2-methyl-6-[[(5-methyl-2-pyrazinyl)amino]carbonyl]-4-benzofuranyl]oxy]- N,N-Dimethyl-5-(2-methyl-6-((5-methylpyrazin-2-yl)carbamoyl)-benzofuran-4- yloxy)pyrimidine-2-carboxamide Pfizer Inc. clinical candidate currently in Phase 2 development. SCHEME REF MedChemComm (2011), 2(9), 828-839 81% WO2010103437 CLINICAL TRIALS A trial to assess the safety, tolerability, pharmacokinetics, and pharmacodynamics of single doses of PF-04937319 …
Tag «PFIZER»
Ervogastat
It’s only fair to share… Ervogastat CAS 2186700-33-2 Non-alcoholic Steatohepatitis (NASH) with Liver Fibrosis (FAST TRACK – U.S.) 2-[5-(3-ethoxypyridin-2-yl)oxypyridin-3-yl]-N-[(3S)-oxolan-3-yl]pyrimidine-5-carboxamide Phase IINon-alcoholic fatty liver disease; Non-alcoholic steatohepatitis Ervogastat is an experimental small-molecule drug and selective diacylglycerol O-acyltransferase 2 inhibitor developed by Pfizer for non-alcoholic steatohepatitis.[1] Its development was previously halted by the company but resumed in 2022.[2] Scheme SIDE CHAIN MAIN https://doi.org/10.1021/acs.jmedchem.2c01200 SYN …
SC-52458, FORASARTAN
It’s only fair to share… SC-52458, FORASARTAN Molecular FormulaC23H28N8 Average mass416.522 Da PHASE 2, PFIZER, HYPERTENSION 145216-43-9 [RN] 5-[(3,5-Dibutyl-1H-1,2,4-triazol-1-yl)methyl]-2-[2-(1H-tetrazol-5-yl)phenyl]pyridine 5-[(3,5-dibutyl-1H-1,2,4-triazol-1-yl)methyl]-2-[2-(2H-1,2,3,4-tetrazol-5-yl)phenyl]pyridine форасартан [Russian] [INN], فوراسارتان[Arabic][INN], 福拉沙坦[Chinese][INN] 065F7WPT0B [DBID] 7415 [DBID] UNII-065F7WPT0B [DBID] SC 52458 [DBID] Type-1 angiotensin II receptor Forasartan, otherwise known as the compound SC-52458, is a nonpeptide angiotensin II receptor antagonist (ARB, AT1 receptor blocker).[2][3][4][5] Forasartan, a specific angiotensin II antagonist, is used alone or with …
Somatrogon
It’s only fair to share… >Somatrogon amino acid sequence SSSSKAPPPSLPSPSRLPGPSDTPILPQFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFE EAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQF LRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHN DDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFSSSSKAPPPSLPSPSRLPGPS DTPILPQSSSSKAPPPSLPSPSRLPGPSDTPILPQ Somatrogon CAS: 1663481-09-1 Protein Chemical FormulaC1359H2125N361O420S7 Protein Average Weight30465.1 Da (Aglycosylated) NGENLA, JAPAN PMDA APPROVED 2022/1/20 ソマトロゴン; MOD-4023 Replenisher (somatotoropin) OriginatorModigene DeveloperOPKO Health; Pfizer ClassBiological proteins; Growth hormones; Hormonal replacements; Recombinant proteins Mechanism of ActionHuman growth hormone replacements Orphan Drug StatusYes – …
PF 04965842, Abrocitinib
It’s only fair to share… PF-04965842 PF 04965842, Abrocitinib UNII: 73SM5SF3OR CAS Number 1622902-68-4, Empirical Formula C14H21N5O2S, Molecular Weight 323.41 N-[cis-3-(Methyl-7H-pyrrolo[2,3-d]pyrimidin-4-ylamino)cyclobutyl]-1-propanesulfonamide, N-((1s,3s)-3-(methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino)cyclobutyl)propane-1-sulfonamide 1-Propanesulfonamide, N-(cis-3-(methyl-7H-pyrrolo(2,3-d)pyrimidin-4-ylamino)cyclobutyl)- N-{cis-3-[Methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino]cyclobutyl}-propane-1-sulfonamide PHASE 3, for the potential oral treatment of moderate-to-severe atopic dermatitis (AD) Jak1 tyrosine kinase inhibitor THE US In February 2018, the FDA granted Breakthrough Therapy designation for the treatment of patients with moderate-to-severe …
PF 06650808
It’s only fair to share… . Picture credit….Bethany Halford PF 06650808 CAS 1822383-80-1 A biologic for cancer treatment (Pfizer Inc.) Originator Pfizer Class Antineoplastics Mechanism of Action Notch-3 receptor antagonists No development reported Solid tumours 24 Jun 2018 Biomarkers information updated 28 Apr 2018 No recent reports of development identified for phase-I development in Solid-tumours(Late-stage disease) in USA (IV) 01 Jul 2017 Pfizer …
Gedatolisib, гедатолисиб , غيداتوليسيب , 吉达利塞 ,
It’s only fair to share… Gedatolisib Pfizer PF-05212384; PF-5212384; PKI-587 CAS 1197160-78-3 Chemical Formula: C32H41N9O4 Molecular Weight: 615.72 1-(4-{[4-(Dimethylamino)-1-piperidinyl]carbonyl}phenyl)-3-{4-[4,6-di(4-morpholinyl)-1,3,5-triazin-2-yl]phenyl}urea 3-{4-[bis(morpholin-4-yl)-1,3,5-triazin-2-yl]phenyl}-1-{4-[4-(dimethylamino)piperidine-1-carbonyl]phenyl}urea N-[4-[[4-(Dimethylamino)-1-piperidinyl]carbonyl]phenyl]-N‘-[4-[4,6-di(4-morpholinyl)-1,3,5-triazin-2-yl]phenyl]urea гедатолисиб [Russian] [INN] غيداتوليسيب [Arabic] [INN] 吉达利塞 [Chinese] [INN] Phase III Acute myeloid leukaemia Phase II Colorectal cancer; Non-small cell lung cancer Phase I Breast cancer; Solid tumours Discontinued Endometrial cancer Most Recent Events 22 Nov 2017Pfizer suspends patient enrolment in a phase I/II …
TAFAMIDIS
It’s only fair to share… Tafamidis Molecular Formula C14H7Cl2NO3 Average mass 308.116 Da TAFAMIDIS, Fx-1006A PF-06291826 2-(3,5-Dichlorophenyl)-1,3-benzoxazole-6-carboxylic acid 594839-88-0 [RN] 6-Benzoxazolecarboxylic acid, 2-(3,5-dichlorophenyl)- Vyndaqel Tafamidis meglumine Familial amyloid polyneuropathy LAUNCHED PFIZER 2011 EU ApprovedJapanese Pharmaceuticals and Medical Devices Agency in September 2013 PHASE 3, at FDA, Amyloidosis, PFIZER Molecular Formula: C21H24Cl2N2O8 Molecular Weight: 503.329 g/mol CAS 951395-08-7 http://www.ema.europa.eu/docs/en_GB/document_library/EPAR_-_Public_assessment_report/human/002294/WC500117838.pdf D-Glucitol, 1-deoxy-1-(methylamino)-, 2-(3,5-dichlorophenyl)-6-benzoxazolecarboxylate Tafamidis (INN, or Fx-1006A,[1] trade …
FDA approves Mylotarg (gemtuzumab ozogamicin) for treatment of acute myeloid leukemia
It’s only fair to share… FDA approves Mylotarg for treatment of acute myeloid leukemia 09/01/2017 The U.S. Food and Drug Administration today approved Mylotarg (gemtuzumab ozogamicin) for the treatment of adults with newly diagnosed acute myeloid leukemia whose tumors express the CD33 antigen (CD33-positive AML). The FDA also approved Mylotarg for the treatment of patients …
PF 2562
It’s only fair to share… PF 2562 CAS 1609258-91-4 MF C19 H17 N5 O MW 331.37 1H-Pyrazolo[4,3-c]pyridine, 4-[4-(4,6-dimethyl-5-pyrimidinyl)-3-methylphenoxy]- Inventors Jennifer Elizabeth Davoren, Amy Beth Dounay, Ivan Viktorovich Efremov, David Lawrence Firman Gray, Scot Richard Mente, Steven Victor O’Neil, Bruce Nelsen Rogers, Chakrapani Subramanyam, Lei Zhang Original Assignee Pfizer Inc Jennifer Elizabeth Davoren Principal Scientist at Pfizer …